Top 5 UK Peptides

Writer： admin Time：2025-06-10 16:11 Browse：℃

What are the best peptides? A question we get asked often. However, the answer is more complex than you may first think. As different peptides are used for different
Peptides are short chains of amino acids, which are the fundamental components in the synthesis of larger proteins. These molecules are connected by peptide bonds, forming precise sequences that can be tailored for various applications.

In the industry, peptides are utilized for a wide range of purposes. Their small size and specific structure make them ideal for applications requiring precision and targeted functionality. We offer a variety of peptide formulations, each designed to meet the specific needs of different sectors, whether for research, industrial processes, or specialized manufacturing.

With different Peptides being used for different research purposes, it is difficult to say which supplements are the most popular. Some of our best sellers include BPC-157, TB500, Ipamorelin, CJC1295 and Epitalon. In this blog, we will take a closer look at our top 5 best sellers!

BPC 157

Product Name: BPC-157 5mg
Molecular Formula: C62H98N16O22
Molecular Weight: 1479.6 g/mol
Purity: 99%
Sequence: H-Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val-OH
Form: Lyophilised Solid

TB500

Peptide Name: TB500 5mg
Molecular Formula: C212/H350/N56/O78/S
Molecular Weight: 4963.4 g/mol
Purity: 98%
Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Form: Lyophilised Solid

Ipamorelin

Product Name: Ipamorelin
Molecular Formula: C38/H49/N9/O5
Molecular Weight:
Purity: >98%
Sequence:H-Aib-His-D-2-Nal-D-Phe-Lys-NH2
Form: Lyophilised Solid

CJC1295

Product Name: CJC1295 with DAC
Molecular Formula: C165/H269/N47/O46
Molecular Weight:
Purity: >98%
Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Mal)-NH2
Form: Lyophilised Solid

Epitalon

Product Name: Epitalon
Molecular Formula: C14/H22/N4/O9
Molecular Weight:
Purity: >98%
Sequence: Ala-Glu-Asp-Gly
Form: Lyophilised Solid

Now, Peptides UK now has one of the biggest varieties of stock in the UK. If you have any questions about any of the products we stock, do not hesitate to contact us for more information and we will be more than happy to assist.